Lineage for d2hlaa2 (2hla A:1-181)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 255210Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 255211Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 255212Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins)
  6. 255238Protein MHC class I, alpha-1 and alpha-2 domains [54468] (19 species)
  7. 255292Species Human (Homo sapiens), HLA-AW68 [TaxId:9606] [54472] (3 PDB entries)
  8. 255295Domain d2hlaa2: 2hla A:1-181 [38259]
    Other proteins in same PDB: d2hlaa1, d2hlab_

Details for d2hlaa2

PDB Entry: 2hla (more details), 2.6 Å

PDB Description: specificity pockets for the side chains of peptide antigens in hla- aw68

SCOP Domain Sequences for d2hlaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hlaa2 d.19.1.1 (A:1-181) MHC class I, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-AW68}
gshsmryfytsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
drntrnvkaqsqtdrvdlgtlrgyynqseagshtiqmmygcdvgsdgrflrgyrqdaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqwraylegtcvewlrrylengketlq
r

SCOP Domain Coordinates for d2hlaa2:

Click to download the PDB-style file with coordinates for d2hlaa2.
(The format of our PDB-style files is described here.)

Timeline for d2hlaa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hlaa1
View in 3D
Domains from other chains:
(mouse over for more information)
d2hlab_