![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily) core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest |
![]() | Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (2 families) ![]() automatically mapped to Pfam PF00510 |
![]() | Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins) function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel |
![]() | Protein Mitochondrial cytochrome c oxidase, subunit III [81445] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [81444] (56 PDB entries) |
![]() | Domain d6juwc_: 6juw C: [382588] Other proteins in same PDB: d6juwa_, d6juwb1, d6juwb2, d6juwd_, d6juwe_, d6juwf_, d6juwg_, d6juwh_, d6juwi_, d6juwj_, d6juwk_, d6juwl_, d6juwm_, d6juwn_, d6juwo1, d6juwo2, d6juwq_, d6juwr_, d6juws_, d6juwt_, d6juwu_, d6juwv_, d6juww_, d6juwx_, d6juwy_, d6juwz_ automated match to d3ag3c_ complexed with cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, po4, psc, tgl, zn |
PDB Entry: 6juw (more details), 1.8 Å
SCOPe Domain Sequences for d6juwc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6juwc_ f.25.1.1 (C:) Mitochondrial cytochrome c oxidase, subunit III {Cow (Bos taurus) [TaxId: 9913]} hqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvi restfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgih plnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyy eapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawyw hfvdvvwlflyvsiywwgs
Timeline for d6juwc_:
![]() Domains from other chains: (mouse over for more information) d6juwa_, d6juwb1, d6juwb2, d6juwd_, d6juwe_, d6juwf_, d6juwg_, d6juwh_, d6juwi_, d6juwj_, d6juwk_, d6juwl_, d6juwm_, d6juwn_, d6juwo1, d6juwo2, d6juwp_, d6juwq_, d6juwr_, d6juws_, d6juwt_, d6juwu_, d6juwv_, d6juww_, d6juwx_, d6juwy_, d6juwz_ |