Lineage for d1tmca_ (1tmc A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 856282Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 856283Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 856284Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 856331Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)
  7. 856460Species Human (Homo sapiens), HLA-AW68 [TaxId:9606] [54472] (3 PDB entries)
  8. 856462Domain d1tmca_: 1tmc A: [38258]
    Other proteins in same PDB: d1tmcb_

Details for d1tmca_

PDB Entry: 1tmc (more details), 2.3 Å

PDB Description: the three-dimensional structure of a class i major histocompatibility complex molecule missing the alpha3 domain of the heavy chain
PDB Compounds: (A:) CLASS I HISTOCOMPATIBILITY ANTIGEN (HLA-Aw68)

SCOP Domain Sequences for d1tmca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tmca_ d.19.1.1 (A:) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-AW68 [TaxId: 9606]}
gshsmryfytsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
drntrnvkaqsqtdrvdlgtlrgyynqseagshtiqmmygcdvgsdgrflrgyrqdaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqwraylegtcvewlrryleng

SCOP Domain Coordinates for d1tmca_:

Click to download the PDB-style file with coordinates for d1tmca_.
(The format of our PDB-style files is described here.)

Timeline for d1tmca_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1tmcb_