Lineage for d1tmca_ (1tmc A:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 131823Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
  4. 131824Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 131825Family d.19.1.1: MHC antigen-recognition domain [54453] (9 proteins)
  6. 131843Protein MHC class I, alpha-1 and alpha-2 domains [54468] (19 species)
  7. 131897Species Human (Homo sapiens), HLA-AW68 [TaxId:9606] [54472] (3 PDB entries)
  8. 131899Domain d1tmca_: 1tmc A: [38258]
    Other proteins in same PDB: d1tmcb_

Details for d1tmca_

PDB Entry: 1tmc (more details), 2.3 Å

PDB Description: the three-dimensional structure of a class i major histocompatibility complex molecule missing the alpha3 domain of the heavy chain

SCOP Domain Sequences for d1tmca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tmca_ d.19.1.1 (A:) MHC class I, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-AW68}
gshsmryfytsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
drntrnvkaqsqtdrvdlgtlrgyynqseagshtiqmmygcdvgsdgrflrgyrqdaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqwraylegtcvewlrryleng

SCOP Domain Coordinates for d1tmca_:

Click to download the PDB-style file with coordinates for d1tmca_.
(The format of our PDB-style files is described here.)

Timeline for d1tmca_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1tmcb_