Lineage for d1hsba2 (1hsb A:1-181)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 78647Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
  4. 78648Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 78649Family d.19.1.1: MHC antigen-recognition domain [54453] (7 proteins)
  6. 78661Protein MHC class I, alpha-1 and alpha-2 domains [54468] (18 species)
  7. 78709Species Human (Homo sapiens), HLA-AW68 [TaxId:9606] [54472] (3 PDB entries)
  8. 78710Domain d1hsba2: 1hsb A:1-181 [38257]
    Other proteins in same PDB: d1hsba1, d1hsbb1

Details for d1hsba2

PDB Entry: 1hsb (more details), 1.9 Å

PDB Description: different length peptides bind to hla-aw68 similarly at their ends but bulge out in the middle

SCOP Domain Sequences for d1hsba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hsba2 d.19.1.1 (A:1-181) MHC class I, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-AW68}
gshsmryfytsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
drntrnvkaqsqtdrvdlgtlrgyynqseagshtiqmmygcdvgsdgrflrgyrqdaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqwraylegtcvewlrrylengketlq
r

SCOP Domain Coordinates for d1hsba2:

Click to download the PDB-style file with coordinates for d1hsba2.
(The format of our PDB-style files is described here.)

Timeline for d1hsba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hsba1
View in 3D
Domains from other chains:
(mouse over for more information)
d1hsbb1