Lineage for d1hsba2 (1hsb A:1-181)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2937656Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2937866Species Human (Homo sapiens), HLA-AW68 [TaxId:9606] [54472] (4 PDB entries)
  8. 2937868Domain d1hsba2: 1hsb A:1-181 [38257]
    Other proteins in same PDB: d1hsba1, d1hsbb_
    complexed with ala, arg

Details for d1hsba2

PDB Entry: 1hsb (more details), 1.9 Å

PDB Description: different length peptides bind to hla-aw68 similarly at their ends but bulge out in the middle
PDB Compounds: (A:) class I histocompatibility antigen (hla-aw68.1)

SCOPe Domain Sequences for d1hsba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hsba2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-AW68 [TaxId: 9606]}
gshsmryfytsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
drntrnvkaqsqtdrvdlgtlrgyynqseagshtiqmmygcdvgsdgrflrgyrqdaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqwraylegtcvewlrrylengketlq
r

SCOPe Domain Coordinates for d1hsba2:

Click to download the PDB-style file with coordinates for d1hsba2.
(The format of our PDB-style files is described here.)

Timeline for d1hsba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hsba1
View in 3D
Domains from other chains:
(mouse over for more information)
d1hsbb_