SCOP 1.59: Domain d1hsad2: 1hsa D:1-181

Lineage for d1hsad2 (1hsa D:1-181)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (9 proteins)

6. Protein MHC class I, alpha-1 and alpha-2 domains [54468] (19 species)

7. Species Human (Homo sapiens), HLA-B2705 [TaxId:9606] [54471] (1 PDB entry)

8. Domain d1hsad2: 1hsa D:1-181 [38256]
   Other proteins in same PDB: d1hsaa1, d1hsab1, d1hsad1, d1hsae1

Details for d1hsad2

PDB Entry: 1hsa, 2.1 Å

PDB Description: the three-dimensional structure of hla-b27 at 2.1 angstroms resolution suggests a general mechanism for tight peptide binding to mhc

SCOP Domain Sequences for d1hsad2:

Sequence; same for both SEQRES and ATOM records:

>d1hsad2 d.19.1.1 (D:1-181) MHC class I, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B2705}
gshsmryfhtsvsrpgrgeprfitvgyvddtlfvrfdsdaaspreeprapwieqegpeyw
dretqickakaqtdredlrtllryynqseagshtlqnmygcdvgpdgrllrgyhqdaydg
kdyialnedlsswtaadtaaqitqrkweaarvaeqlraylegecvewlrrylengketlq
r

Timeline for d1hsad2:

• d1hsad2 first appeared (with stable ids) in SCOP 1.55
  
• d1hsad2 appears in SCOP 1.57
  
• d1hsad2 appears in SCOP 1.61
  
• d1hsad2 appears in the current release, SCOPe 2.08