SCOPe 2.03: Domain d1i1fd2: 1i1f D:1-181

Lineage for d1i1fd2 (1i1f D:1-181)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species)

7. Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (92 PDB entries)
   Uniprot P01892 25-298

8. Domain d1i1fd2: 1i1f D:1-181 [38254]
   Other proteins in same PDB: d1i1fa1, d1i1fb_, d1i1fd1, d1i1fe_

Details for d1i1fd2

PDB Entry: 1i1f, 2.8 Å

PDB Description: crystal structure of human class i mhc (hla-a2.1) complexed with beta 2-microglobulin and hiv-rt variant peptide i1y

PDB Compounds: (D:) protein (class I histocompatibility antigen, gogo-a0201 alpha chain)

SCOPe Domain Sequences for d1i1fd2:

Sequence; same for both SEQRES and ATOM records:

>d1i1fd2 d.19.1.1 (D:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

Timeline for d1i1fd2:

• d1i1fd2 first appeared (with stable ids) in SCOP 1.55
  
• d1i1fd2 appears in SCOPe 2.02
  
• d1i1fd2 appears in SCOPe 2.04
  
• d1i1fd2 appears in the current release, SCOPe 2.08