Lineage for d1i1fa2 (1i1f A:1-181)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 190293Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
  4. 190294Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 190295Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins)
  6. 190321Protein MHC class I, alpha-1 and alpha-2 domains [54468] (19 species)
  7. 190330Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (27 PDB entries)
  8. 190369Domain d1i1fa2: 1i1f A:1-181 [38253]
    Other proteins in same PDB: d1i1fa1, d1i1fb1, d1i1fd1, d1i1fe1

Details for d1i1fa2

PDB Entry: 1i1f (more details), 2.8 Å

PDB Description: crystal structure of human class i mhc (hla-a2.1) complexed with beta 2-microglobulin and hiv-rt variant peptide i1y

SCOP Domain Sequences for d1i1fa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i1fa2 d.19.1.1 (A:1-181) MHC class I, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

SCOP Domain Coordinates for d1i1fa2:

Click to download the PDB-style file with coordinates for d1i1fa2.
(The format of our PDB-style files is described here.)

Timeline for d1i1fa2: