Lineage for d6xv4a_ (6xv4 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2333057Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2333058Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2333059Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 2333060Protein Ascorbate peroxidase [48123] (3 species)
  7. 2333066Species Soybean (Glycine max) [TaxId:3847] [89092] (15 PDB entries)
    Uniprot Q43758
  8. 2333077Domain d6xv4a_: 6xv4 A: [382522]
    automated match to d1oaga_
    complexed with asc, dod, hem, k, so4

Details for d6xv4a_

PDB Entry: 6xv4 (more details), 1.9 Å

PDB Description: neutron structure of ferric ascorbate peroxidase-ascorbate complex
PDB Compounds: (A:) ascorbate peroxidase

SCOPe Domain Sequences for d6xv4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6xv4a_ a.93.1.1 (A:) Ascorbate peroxidase {Soybean (Glycine max) [TaxId: 3847]}
gksyptvsadyqkavekakkklrgfiaekrcaplmlrlawhsagtfdkgtktggpfgtik
hpaelahsanngldiavrlleplkaefpilsyadfyqlagvvavevtggpevpfhpgred
kpepppegrlpdatkgsdhlrdvfgkamgltdqdivalsgghtigaahkersgfegpwts
nplifdnsyftellsgekegllqlpsdkallsdpvfrplvdkyaadedaffadyaeahqk
lselgfad

SCOPe Domain Coordinates for d6xv4a_:

Click to download the PDB-style file with coordinates for d6xv4a_.
(The format of our PDB-style files is described here.)

Timeline for d6xv4a_: