SCOPe 2.08: Domain d6t6ra3: 6t6r A:530-614

Lineage for d6t6ra3 (6t6r A:530-614)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families)
   same topology as (b.1.15.1)

5. Family b.1.30.0: automated matches [254306] (1 protein)
   not a true family

6. Protein automated matches [254707] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255965] (22 PDB entries)

8. Domain d6t6ra3: 6t6r A:530-614 [382492]
   Other proteins in same PDB: d6t6ra1, d6t6ra2, d6t6ra4
   automated match to d2xdta3
   complexed with edo, mlt, mnz, zn

Details for d6t6ra3

PDB Entry: 6t6r, 1.67 Å

PDB Description: human endoplasmic reticulum aminopeptidase 1 (erap1) in complex with (4ar,5s,6r,8s,8ar)-5-(2-(furan-3-yl)ethyl)-8-hydroxy-5,6,8a- trimethyl-3,4,4a,5,6,7,8,8a-octahydronaphthalene-1-carboxylic acid

PDB Compounds: (A:) endoplasmic reticulum aminopeptidase 1

SCOPe Domain Sequences for d6t6ra3:

Sequence, based on SEQRES records:

>d6t6ra3 b.1.30.0 (A:530-614) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fplititvrgrnvhmkqehymkgsdgapdtgylwhvpltfitsksdmvhrfllktktdvl
ilpeevewikfnvgmngyyivhyed

Sequence, based on observed residues (ATOM records):

>d6t6ra3 b.1.30.0 (A:530-614) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fplititvrgrnvhmkqehymkggylwhvpltfitsksdmvhrfllktktdvlilpeeve
wikfnvgmngyyivhyed

Timeline for d6t6ra3:

• d6t6ra3 first appeared in SCOPe 2.07