Lineage for d6t6ra1 (6t6r A:45-254)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2820567Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily)
    duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain
  4. 2820568Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families) (S)
  5. 2820655Family b.98.1.0: automated matches [254305] (1 protein)
    not a true family
  6. 2820656Protein automated matches [254706] (5 species)
    not a true protein
  7. 2820660Species Human (Homo sapiens) [TaxId:9606] [255964] (28 PDB entries)
  8. 2820668Domain d6t6ra1: 6t6r A:45-254 [382490]
    Other proteins in same PDB: d6t6ra2, d6t6ra3, d6t6ra4
    automated match to d2xdta1
    complexed with edo, mlt, mnz, zn

Details for d6t6ra1

PDB Entry: 6t6r (more details), 1.67 Å

PDB Description: human endoplasmic reticulum aminopeptidase 1 (erap1) in complex with (4ar,5s,6r,8s,8ar)-5-(2-(furan-3-yl)ethyl)-8-hydroxy-5,6,8a- trimethyl-3,4,4a,5,6,7,8,8a-octahydronaphthalene-1-carboxylic acid
PDB Compounds: (A:) endoplasmic reticulum aminopeptidase 1

SCOPe Domain Sequences for d6t6ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6t6ra1 b.98.1.0 (A:45-254) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tpfpwnkirlpeyvipvhydllihaqlttltfwgttkveitasqptstiilhshhlqisr
atlrkgagerlseeplqvlehprqeqiallapepllvglpytvvihyagqlsetfhgfyk
styrtkegelrilastqfeptaarmafpcfdepafkasfsikirreprhlaisnmplvks
vtvaegliedhfdvtvkmstylvafiisdf

SCOPe Domain Coordinates for d6t6ra1:

Click to download the PDB-style file with coordinates for d6t6ra1.
(The format of our PDB-style files is described here.)

Timeline for d6t6ra1: