Lineage for d1b0ra2 (1b0r A:1-181)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 190293Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
  4. 190294Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 190295Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins)
  6. 190321Protein MHC class I, alpha-1 and alpha-2 domains [54468] (19 species)
  7. 190330Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (27 PDB entries)
  8. 190368Domain d1b0ra2: 1b0r A:1-181 [38249]
    Other proteins in same PDB: d1b0ra1, d1b0rb1

Details for d1b0ra2

PDB Entry: 1b0r (more details), 2.9 Å

PDB Description: crystal structure of hla-a*0201 complexed with a peptide with the carboxyl-terminal group substituted by a methyl group

SCOP Domain Sequences for d1b0ra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b0ra2 d.19.1.1 (A:1-181) MHC class I, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

SCOP Domain Coordinates for d1b0ra2:

Click to download the PDB-style file with coordinates for d1b0ra2.
(The format of our PDB-style files is described here.)

Timeline for d1b0ra2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b0ra1
View in 3D
Domains from other chains:
(mouse over for more information)
d1b0rb1