Lineage for d1hhgd2 (1hhg D:1-181)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1897191Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1897192Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1897193Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1897285Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species)
  7. 1897312Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (92 PDB entries)
    Uniprot P01892 25-298
  8. 1897452Domain d1hhgd2: 1hhg D:1-181 [38248]
    Other proteins in same PDB: d1hhga1, d1hhgb_, d1hhgd1, d1hhge_

Details for d1hhgd2

PDB Entry: 1hhg (more details), 2.6 Å

PDB Description: the antigenic identity of peptide(slash)mhc complexes: a comparison of the conformation of five peptides presented by hla-a2
PDB Compounds: (D:) class I histocompatibility antigen (hla-a*0201) (alpha chain)

SCOPe Domain Sequences for d1hhgd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hhgd2 d.19.1.1 (D:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

SCOPe Domain Coordinates for d1hhgd2:

Click to download the PDB-style file with coordinates for d1hhgd2.
(The format of our PDB-style files is described here.)

Timeline for d1hhgd2: