Lineage for d1hhga2 (1hhg A:1-181)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 326693Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 326694Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 326695Family d.19.1.1: MHC antigen-recognition domain [54453] (11 proteins)
  6. 326714Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (19 species)
  7. 326717Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (30 PDB entries)
  8. 326758Domain d1hhga2: 1hhg A:1-181 [38247]
    Other proteins in same PDB: d1hhga1, d1hhgb_, d1hhgd1, d1hhge_

Details for d1hhga2

PDB Entry: 1hhg (more details), 2.6 Å

PDB Description: the antigenic identity of peptide(slash)mhc complexes: a comparison of the conformation of five peptides presented by hla-a2

SCOP Domain Sequences for d1hhga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hhga2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

SCOP Domain Coordinates for d1hhga2:

Click to download the PDB-style file with coordinates for d1hhga2.
(The format of our PDB-style files is described here.)

Timeline for d1hhga2: