Lineage for d1qr1d2 (1qr1 D:1-181)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2182595Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2182596Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2182597Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2182691Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2182718Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (101 PDB entries)
    Uniprot P01892 25-298
  8. 2182825Domain d1qr1d2: 1qr1 D:1-181 [38246]
    Other proteins in same PDB: d1qr1a1, d1qr1b_, d1qr1d1, d1qr1e_

Details for d1qr1d2

PDB Entry: 1qr1 (more details), 2.4 Å

PDB Description: poor binding of a her-2/neu epitope (gp2) to hla-a2.1 is due to a lack of interactions in the center of the peptide
PDB Compounds: (D:) hla-a2.1 heavy chain

SCOPe Domain Sequences for d1qr1d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qr1d2 d.19.1.1 (D:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

SCOPe Domain Coordinates for d1qr1d2:

Click to download the PDB-style file with coordinates for d1qr1d2.
(The format of our PDB-style files is described here.)

Timeline for d1qr1d2: