Lineage for d6qstd_ (6qst D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2706694Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2706695Family a.29.2.1: Bromodomain [47371] (6 proteins)
  6. 2706696Protein CREB-binding protein, CBP [74712] (2 species)
  7. 2706697Species Human (Homo sapiens) [TaxId:9606] [74713] (59 PDB entries)
  8. 2706782Domain d6qstd_: 6qst D: [382437]
    automated match to d4nyxa_
    complexed with jgk

Details for d6qstd_

PDB Entry: 6qst (more details), 2.1 Å

PDB Description: structure of crebbp bromodomain with compound 2 bound
PDB Compounds: (D:) creb-binding protein

SCOPe Domain Sequences for d6qstd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6qstd_ a.29.2.1 (D:) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]}
fkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikrkldt
gqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqslg

SCOPe Domain Coordinates for d6qstd_:

Click to download the PDB-style file with coordinates for d6qstd_.
(The format of our PDB-style files is described here.)

Timeline for d6qstd_: