Class a: All alpha proteins [46456] (290 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.2: Bromodomain [47370] (2 families) |
Family a.29.2.1: Bromodomain [47371] (6 proteins) |
Protein CREB-binding protein, CBP [74712] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [74713] (59 PDB entries) |
Domain d6qstd_: 6qst D: [382437] automated match to d4nyxa_ complexed with jgk |
PDB Entry: 6qst (more details), 2.1 Å
SCOPe Domain Sequences for d6qstd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6qstd_ a.29.2.1 (D:) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]} fkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikrkldt gqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqslg
Timeline for d6qstd_: