SCOP 1.57: Domain d1hhja2: 1hhj A:1-181

Lineage for d1hhja2 (1hhj A:1-181)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (7 proteins)

6. Protein MHC class I, alpha-1 and alpha-2 domains [54468] (18 species)

7. Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (24 PDB entries)

8. Domain d1hhja2: 1hhj A:1-181 [38241]
   Other proteins in same PDB: d1hhja1, d1hhjb1, d1hhjd1, d1hhje1

Details for d1hhja2

PDB Entry: 1hhj, 2.5 Å

PDB Description: the antigenic identity of peptide(slash)mhc complexes: a comparison of the conformation of five peptides presented by hla-a2

SCOP Domain Sequences for d1hhja2:

Sequence; same for both SEQRES and ATOM records:

>d1hhja2 d.19.1.1 (A:1-181) MHC class I, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

Timeline for d1hhja2:

• d1hhja2 first appeared (with stable ids) in SCOP 1.55
  
• d1hhja2 appears in SCOP 1.59
  
• d1hhja2 appears in the current release, SCOPe 2.08