SCOPe 2.08: Domain d6sm2b_: 6sm2 B:

Lineage for d6sm2b_ (6sm2 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)

8. Domain d6sm2b_: 6sm2 B: [382395]
   automated match to d2rhea_
   mutant

Details for d6sm2b_

PDB Entry: 6sm2, 2.5 Å

PDB Description: mutant immunoglobulin light chain causing amyloidosis (pat-1)

PDB Compounds: (B:) Pat-1

SCOPe Domain Sequences for d6sm2b_:

Sequence; same for both SEQRES and ATOM records:

>d6sm2b_ b.1.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
altqpasvsgslgqsitisctgssndfgdynyvswyqqhpgkapklmiydvdnrpsgvsn
rfsgsksgntasltisgvlaedeadyfcssytssstlyvfgsgtkvtvl

Timeline for d6sm2b_:

• d6sm2b_ first appeared in SCOPe 2.07