Lineage for d1i1yd2 (1i1y D:1-181)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1897191Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1897192Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1897193Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1897285Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species)
  7. 1897312Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (92 PDB entries)
    Uniprot P01892 25-298
  8. 1897394Domain d1i1yd2: 1i1y D:1-181 [38231]
    Other proteins in same PDB: d1i1ya1, d1i1yb_, d1i1yd1, d1i1ye_

Details for d1i1yd2

PDB Entry: 1i1y (more details), 2.2 Å

PDB Description: crystal structure of human class i mhc (hla-a2.1) complexed with beta 2-microglobulin and hiv-rt variant peptide i1y
PDB Compounds: (D:) class I histocompatibility antigen

SCOPe Domain Sequences for d1i1yd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i1yd2 d.19.1.1 (D:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

SCOPe Domain Coordinates for d1i1yd2:

Click to download the PDB-style file with coordinates for d1i1yd2.
(The format of our PDB-style files is described here.)

Timeline for d1i1yd2: