Lineage for d1duza2 (1duz A:1-181)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1405985Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1405986Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1405987Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1406058Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species)
  7. 1406071Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (92 PDB entries)
    Uniprot P01892 25-298
  8. 1406107Domain d1duza2: 1duz A:1-181 [38224]
    Other proteins in same PDB: d1duza1, d1duzb_, d1duzd1, d1duze_

Details for d1duza2

PDB Entry: 1duz (more details), 1.8 Å

PDB Description: human class i histocompatibility antigen (hla-a 0201) in complex with a nonameric peptide from htlv-1 tax protein
PDB Compounds: (A:) hla-a*0201

SCOPe Domain Sequences for d1duza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1duza2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

SCOPe Domain Coordinates for d1duza2:

Click to download the PDB-style file with coordinates for d1duza2.
(The format of our PDB-style files is described here.)

Timeline for d1duza2: