SCOPe 2.01: Domain d1hlaa2: 1hla A:1-181

Lineage for d1hlaa2 (1hla A:1-181)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)

7. Species Human (Homo sapiens), HLA-A2 [TaxId:9606] [54469] (1 PDB entry)

8. Domain d1hlaa2: 1hla A:1-181 [38223]
   Other proteins in same PDB: d1hlaa1, d1hlam_
   CA-atoms only

Details for d1hlaa2

PDB Entry: 1hla, 3.5 Å

PDB Description: structure of the human class i histocompatibility antigen, hla-a2

PDB Compounds: (A:) class I histocompatibility antigen (hla-a2) (alpha chain)

SCOPe Domain Sequences for d1hlaa2:

Sequence; same for both SEQRES and ATOM records:

>d1hlaa2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

Timeline for d1hlaa2:

• d1hlaa2 first appeared (with stable ids) in SCOP 1.55
  
• d1hlaa2 appears in SCOP 1.75
  
• d1hlaa2 appears in SCOPe 2.02
  
• d1hlaa2 appears in the current release, SCOPe 2.08