SCOP 1.71: Domain d1hlaa2: 1hla A:1-181

Lineage for d1hlaa2 (1hla A:1-181)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (22 species)

7. Species Human (Homo sapiens), HLA-A2 [TaxId:9606] [54469] (1 PDB entry)

8. Domain d1hlaa2: 1hla A:1-181 [38223]
   Other proteins in same PDB: d1hlaa1, d1hlam_
   CA-atoms only

Details for d1hlaa2

PDB Entry: 1hla, 3.5 Å

PDB Description: structure of the human class i histocompatibility antigen, hla-a2

SCOP Domain Sequences for d1hlaa2:

Sequence; same for both SEQRES and ATOM records:

>d1hlaa2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

Timeline for d1hlaa2:

• d1hlaa2 first appeared (with stable ids) in SCOP 1.55
  
• d1hlaa2 appears in SCOP 1.69
  
• d1hlaa2 appears in SCOP 1.73
  
• d1hlaa2 appears in the current release, SCOPe 2.08