Lineage for d1hlaa2 (1hla A:1-181)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 31165Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
  4. 31166Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 31167Family d.19.1.1: MHC antigen-recognition domain [54453] (7 proteins)
  6. 31179Protein MHC class I, alpha-1 and alpha-2 domains [54468] (18 species)
  7. 31186Species Human (Homo sapiens), HLA-A2 [TaxId:9606] [54469] (1 PDB entry)
  8. 31187Domain d1hlaa2: 1hla A:1-181 [38223]
    Other proteins in same PDB: d1hlaa1, d1hlam1

Details for d1hlaa2

PDB Entry: 1hla (more details), 3.5 Å

PDB Description: structure of the human class i histocompatibility antigen, hla-a2
PDB Compounds: (A:)

SCOP Domain Sequences for d1hlaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hlaa2 d.19.1.1 (A:1-181) MHC class I, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

SCOP Domain Coordinates for d1hlaa2:

Click to download the PDB-style file with coordinates for d1hlaa2.
(The format of our PDB-style files is described here.)

Timeline for d1hlaa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hlaa1
View in 3D
Domains from other chains:
(mouse over for more information)
d1hlam1