SCOPe 2.08: Domain d6w01b2: 6w01 B:192-346

Lineage for d6w01b2 (6w01 B:192-346)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.294: EndoU-like [142876] (1 superfamily)
   comprises several helices and two three-stranded antiparallel beta-sheets; similar architecture to the RNase A-like fold (54075)

4. Superfamily d.294.1: EndoU-like [142877] (3 families)
   similarity to the RNase A-like superfamily (54076) extends to the active site location and architecture; the two structural cores of the RNase A and EndoU superfamilies are interrelated by a topological permutation - transposition of two pereferial beta-strands, suggesting possible distant homology of the two superfamilies (and their unification in a hyperfamily)

5. Family d.294.1.0: automated matches [356574] (1 protein)
   not a true family

6. Protein automated matches [356575] (3 species)
   not a true protein

7. Species Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049] [382219] (7 PDB entries)

8. Domain d6w01b2: 6w01 B:192-346 [382220]
   Other proteins in same PDB: d6w01a1, d6w01a3, d6w01b1, d6w01b3
   automated match to d2h85a2
   complexed with cit, edo, peg

Details for d6w01b2

PDB Entry: 6w01, 1.9 Å

PDB Description: the 1.9 a crystal structure of nsp15 endoribonuclease from sars cov-2 in the complex with a citrate

PDB Compounds: (B:) Uridylate-specific endoribonuclease

SCOPe Domain Sequences for d6w01b2:

Sequence; same for both SEQRES and ATOM records:

>d6w01b2 d.294.1.0 (B:192-346) automated matches {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]}
etyftqsrnlqefkprsqmeidflelamdefieryklegyafehivygdfshsqlgglhl
liglakrfkespfeledfipmdstvknyfitdaqtgsskcvcsvidlllddfveiiksqd
lsvvskvvkvtidyteisfmlwckdghvetfypkl

Timeline for d6w01b2:

• d6w01b2 first appeared in SCOPe 2.07