SCOP 1.67: Domain d1f3jd2: 1f3j D:1-82

Lineage for d1f3jd2 (1f3j D:1-82)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (11 proteins)

6. Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)

7. Species Mouse (Mus musculus), I-A(G7) [TaxId:10090] [88817] (2 PDB entries)

8. Domain d1f3jd2: 1f3j D:1-82 [38221]
   Other proteins in same PDB: d1f3ja1, d1f3jb1, d1f3jb2, d1f3jd1, d1f3je1, d1f3je2
   complexed with nag

Details for d1f3jd2

PDB Entry: 1f3j, 3.1 Å

PDB Description: histocompatibility antigen i-ag7

SCOP Domain Sequences for d1f3jd2:

Sequence; same for both SEQRES and ATOM records:

>d1f3jd2 d.19.1.1 (D:1-82) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), I-A(G7)}
ieadhvgfygttvyqspgdigqythefdgdelfyvdldkkktvwrlpefgqlilfepqgg
lqniaaekhnlgiltkrsnftpa

Timeline for d1f3jd2:

• d1f3jd2 first appeared (with stable ids) in SCOP 1.55
  
• d1f3jd2 appears in SCOP 1.65
  
• d1f3jd2 appears in SCOP 1.69
  
• d1f3jd2 appears in the current release, SCOPe 2.08