Lineage for d6rl5c_ (6rl5 C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2502820Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2502821Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2504326Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2504327Protein automated matches [190151] (160 species)
    not a true protein
  7. 2504613Species Chromohalobacter salexigens [TaxId:290398] [382132] (1 PDB entry)
  8. 2504616Domain d6rl5c_: 6rl5 C: [382165]
    automated match to d1szsa1
    complexed with plp

Details for d6rl5c_

PDB Entry: 6rl5 (more details), 2.45 Å

PDB Description: the first crystal structure of the daba aminotransferase ectb in the ectoine biosynthesis pathway of the model organism chromohalobacter salexigens dsm 3034
PDB Compounds: (C:) Diaminobutyrate--2-oxoglutarate transaminase

SCOPe Domain Sequences for d6rl5c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6rl5c_ c.67.1.0 (C:) automated matches {Chromohalobacter salexigens [TaxId: 290398]}
tqilermesevrtysrsfptvfteakgarlhaedgnqyidflagagtlnyghnhpklkqa
ladyiasdgivhgldmwsaakrdyletleevilkprgldykvhlpgptgtnaveaairla
rnakgrhnivtftngfhgvtmgalattgnrkfreatggiptqgasfmpfdgymgegvdtl
syfekllgdnsggldvpaaviietvqgegginpagipwlqrlekicrdhdmllivddiqa
gcgrtgkffsfehagitpdivtnskslsgfglpfahvlmrpeldiwkpgqyngtfrgfnl
afvtaaaamrhfwsddtferdvqrkgrvvedrfqklasfmtekghpasergrglmrgldv
gdgdmadkitaqafkngliietsghsgqvikclcpltitdedlvggldileqsvkevfg

SCOPe Domain Coordinates for d6rl5c_:

Click to download the PDB-style file with coordinates for d6rl5c_.
(The format of our PDB-style files is described here.)

Timeline for d6rl5c_: