Lineage for d1iaob2 (1iao B:6-93)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1197982Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1197983Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 1197984Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1198561Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 1198655Species Mouse (Mus musculus), I-AD [TaxId:10090] [88829] (2 PDB entries)
  8. 1198657Domain d1iaob2: 1iao B:6-93 [38216]
    Other proteins in same PDB: d1iaoa1, d1iaoa2, d1iaob1
    complexed with nag

Details for d1iaob2

PDB Entry: 1iao (more details), 2.6 Å

PDB Description: class ii mhc i-ad in complex with ovalbumin peptide 323-339
PDB Compounds: (B:) MHC class II I-ad

SCOPe Domain Sequences for d1iaob2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iaob2 d.19.1.1 (B:6-93) Class II MHC beta chain, N-terminal domain {Mouse (Mus musculus), I-AD [TaxId: 10090]}
hfvvqfkgecyytngtqrirlvtryiynreeyvrydsdvgeyravtelgrpdaeywnsqp
eildrtraevdtacrhnyegpetstslr

SCOPe Domain Coordinates for d1iaob2:

Click to download the PDB-style file with coordinates for d1iaob2.
(The format of our PDB-style files is described here.)

Timeline for d1iaob2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1iaob1