Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class II MHC beta chain, N-terminal domain [88819] (15 species) |
Species Mouse (Mus musculus), I-AD [TaxId:10090] [88829] (2 PDB entries) |
Domain d1iaob2: 1iao B:6-93 [38216] Other proteins in same PDB: d1iaoa1, d1iaoa2, d1iaob1 complexed with nag |
PDB Entry: 1iao (more details), 2.6 Å
SCOPe Domain Sequences for d1iaob2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iaob2 d.19.1.1 (B:6-93) Class II MHC beta chain, N-terminal domain {Mouse (Mus musculus), I-AD [TaxId: 10090]} hfvvqfkgecyytngtqrirlvtryiynreeyvrydsdvgeyravtelgrpdaeywnsqp eildrtraevdtacrhnyegpetstslr
Timeline for d1iaob2: