Lineage for d1iaoa2 (1iao A:1-82)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 501112Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 501113Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 501114Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 501366Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)
  7. 501431Species Mouse (Mus musculus), I-AD [TaxId:10090] [88816] (2 PDB entries)
  8. 501433Domain d1iaoa2: 1iao A:1-82 [38215]
    Other proteins in same PDB: d1iaoa1, d1iaob1, d1iaob2

Details for d1iaoa2

PDB Entry: 1iao (more details), 2.6 Å

PDB Description: class ii mhc i-ad in complex with ovalbumin peptide 323-339
PDB Compounds: (A:)

SCOP Domain Sequences for d1iaoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iaoa2 d.19.1.1 (A:1-82) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), I-AD}
eadhvgfygttvyqspgdigqythefdgdelfyvdldkkktvwrlpefgqlilfepqggl
qniaaekhnlgiltkrsnftpa

SCOP Domain Coordinates for d1iaoa2:

Click to download the PDB-style file with coordinates for d1iaoa2.
(The format of our PDB-style files is described here.)

Timeline for d1iaoa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1iaoa1