Lineage for d2iadb2 (2iad B:5-93)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 31165Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
  4. 31166Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 31167Family d.19.1.1: MHC antigen-recognition domain [54453] (7 proteins)
  6. 31290Protein MHC class II, N-terminal domains of alpha and beta chains [54458] (9 species)
  7. 31345Species Mouse (Mus musculus), I-AD [TaxId:10090] [54466] (2 PDB entries)
  8. 31347Domain d2iadb2: 2iad B:5-93 [38214]
    Other proteins in same PDB: d2iada1, d2iadb1

Details for d2iadb2

PDB Entry: 2iad (more details), 2.4 Å

PDB Description: class ii mhc i-ad in complex with an influenza hemagglutinin peptide 126-138

SCOP Domain Sequences for d2iadb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iadb2 d.19.1.1 (B:5-93) MHC class II, N-terminal domains of alpha and beta chains {Mouse (Mus musculus), I-AD}
rhfvvqfkgecyytngtqrirlvtryiynreeyvrydsdvgeyravtelgrpdaeywnsq
peilertraevdtacrhnyegpetstslr

SCOP Domain Coordinates for d2iadb2:

Click to download the PDB-style file with coordinates for d2iadb2.
(The format of our PDB-style files is described here.)

Timeline for d2iadb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2iadb1