SCOPe 2.08: Domain d6rk3a1: 6rk3 A:1-63

Lineage for d6rk3a1 (6rk3 A:1-63)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families)
   many known members contain KOW motif

5. Family b.34.5.0: automated matches [227245] (1 protein)
   not a true family

6. Protein automated matches [227015] (11 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [382134] (1 PDB entry)

8. Domain d6rk3a1: 6rk3 A:1-63 [382135]
   Other proteins in same PDB: d6rk3a2, d6rk3a3
   automated match to d1ueba1

Details for d6rk3a1

PDB Entry: 6rk3

PDB Description: solution structure of the ribosome elongation factor p (ef-p) from staphylococcus aureus

PDB Compounds: (A:) elongation factor P

SCOPe Domain Sequences for d6rk3a1:

Sequence; same for both SEQRES and ATOM records:

>d6rk3a1 b.34.5.0 (A:1-63) automated matches {Staphylococcus aureus [TaxId: 1280]}
misvndfktgltisvdnaiwkvidfqhvkpgkgsafvrsklrnlrtgaiqektfragekv
epa

Timeline for d6rk3a1:

• d6rk3a1 first appeared in SCOPe 2.07