Class b: All beta proteins [48724] (180 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) many known members contain KOW motif |
Family b.34.5.0: automated matches [227245] (1 protein) not a true family |
Protein automated matches [227015] (11 species) not a true protein |
Species Staphylococcus aureus [TaxId:1280] [382134] (1 PDB entry) |
Domain d6rk3a1: 6rk3 A:1-63 [382135] Other proteins in same PDB: d6rk3a2, d6rk3a3 automated match to d1ueba1 |
PDB Entry: 6rk3 (more details)
SCOPe Domain Sequences for d6rk3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6rk3a1 b.34.5.0 (A:1-63) automated matches {Staphylococcus aureus [TaxId: 1280]} misvndfktgltisvdnaiwkvidfqhvkpgkgsafvrsklrnlrtgaiqektfragekv epa
Timeline for d6rk3a1: