Lineage for d2iada2 (2iad A:1A-82)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 326693Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 326694Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 326695Family d.19.1.1: MHC antigen-recognition domain [54453] (11 proteins)
  6. 326895Protein Class II MHC alpha chain, N-terminal domain [88806] (13 species)
  7. 326947Species Mouse (Mus musculus), I-AD [TaxId:10090] [88816] (2 PDB entries)
  8. 326948Domain d2iada2: 2iad A:1A-82 [38213]
    Other proteins in same PDB: d2iada1, d2iadb1, d2iadb2

Details for d2iada2

PDB Entry: 2iad (more details), 2.4 Å

PDB Description: class ii mhc i-ad in complex with an influenza hemagglutinin peptide 126-138

SCOP Domain Sequences for d2iada2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iada2 d.19.1.1 (A:1A-82) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), I-AD}
ieadhvgfygttvyqspgdigqythefdgdelfyvdldkkktvwrlpefgqlilfepqgg
lqniaaekhnlgiltkrsnftpa

SCOP Domain Coordinates for d2iada2:

Click to download the PDB-style file with coordinates for d2iada2.
(The format of our PDB-style files is described here.)

Timeline for d2iada2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2iada1