Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class II MHC beta chain, N-terminal domain [88819] (15 species) |
Species Mouse (Mus musculus), I-EK [TaxId:10090] [88827] (9 PDB entries) |
Domain d1iebd2: 1ieb D:4-92 [38212] Other proteins in same PDB: d1ieba1, d1ieba2, d1iebb1, d1iebc1, d1iebc2, d1iebd1 contains covalently bound peptides at the N-termini of chains B and D complexed with nag, ndg, so4 |
PDB Entry: 1ieb (more details), 2.7 Å
SCOPe Domain Sequences for d1iebd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iebd2 d.19.1.1 (D:4-92) Class II MHC beta chain, N-terminal domain {Mouse (Mus musculus), I-EK [TaxId: 10090]} rpwfleycksechfyngtqrvrllvryfynleenlrfdsdvgefravtelgrpdaenwns qpefleqkraevdtvcrhnyeifdnflvp
Timeline for d1iebd2: