![]() | Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins) |
![]() | Protein Class II MHC beta chain, N-terminal domain [88819] (15 species) |
![]() | Species Mouse (Mus musculus), I-EK [TaxId:10090] [88827] (9 PDB entries) |
![]() | Domain d1iebd2: 1ieb D:4-92 [38212] Other proteins in same PDB: d1ieba1, d1ieba2, d1iebb1, d1iebc1, d1iebc2, d1iebd1 contains covalently bound peptides at the N-termini of chains B and D |
PDB Entry: 1ieb (more details), 2.7 Å
SCOP Domain Sequences for d1iebd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iebd2 d.19.1.1 (D:4-92) Class II MHC beta chain, N-terminal domain {Mouse (Mus musculus), I-EK} rpwfleycksechfyngtqrvrllvryfynleenlrfdsdvgefravtelgrpdaenwns qpefleqkraevdtvcrhnyeifdnflvp
Timeline for d1iebd2: