Lineage for d1iebd2 (1ieb D:4-92)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 501112Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 501113Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 501114Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 501462Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 501537Species Mouse (Mus musculus), I-EK [TaxId:10090] [88827] (9 PDB entries)
  8. 501553Domain d1iebd2: 1ieb D:4-92 [38212]
    Other proteins in same PDB: d1ieba1, d1ieba2, d1iebb1, d1iebc1, d1iebc2, d1iebd1
    contains covalently bound peptides at the N-termini of chains B and D

Details for d1iebd2

PDB Entry: 1ieb (more details), 2.7 Å

PDB Description: histocompatibility antigen

SCOP Domain Sequences for d1iebd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iebd2 d.19.1.1 (D:4-92) Class II MHC beta chain, N-terminal domain {Mouse (Mus musculus), I-EK}
rpwfleycksechfyngtqrvrllvryfynleenlrfdsdvgefravtelgrpdaenwns
qpefleqkraevdtvcrhnyeifdnflvp

SCOP Domain Coordinates for d1iebd2:

Click to download the PDB-style file with coordinates for d1iebd2.
(The format of our PDB-style files is described here.)

Timeline for d1iebd2: