![]() | Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (11 proteins) |
![]() | Protein Class II MHC alpha chain, N-terminal domain [88806] (13 species) |
![]() | Species Mouse (Mus musculus), I-EK [TaxId:10090] [88814] (7 PDB entries) |
![]() | Domain d1iebc2: 1ieb C:1-81 [38211] Other proteins in same PDB: d1ieba1, d1iebb1, d1iebb2, d1iebc1, d1iebd1, d1iebd2 complexed with nag, so4 |
PDB Entry: 1ieb (more details), 2.7 Å
SCOP Domain Sequences for d1iebc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iebc2 d.19.1.1 (C:1-81) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), I-EK} ikeehtiiqaefyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal aniavdkanldvmkersnntp
Timeline for d1iebc2: