Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins) |
Protein Class II MHC beta chain, N-terminal domain [88819] (15 species) |
Species Mouse (Mus musculus), I-EK [TaxId:10090] [88827] (9 PDB entries) |
Domain d1iead2: 1iea D:4-92 [38208] Other proteins in same PDB: d1ieaa1, d1ieaa2, d1ieab1, d1ieac1, d1ieac2, d1iead1 contains covalently bound peptides at the N-termini of chains B and D |
PDB Entry: 1iea (more details), 2.3 Å
SCOP Domain Sequences for d1iead2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iead2 d.19.1.1 (D:4-92) Class II MHC beta chain, N-terminal domain {Mouse (Mus musculus), I-EK} rpwfleycksechfyngtqrvrllvryfynleenlrfdsdvgefravtelgrpdaenwns qpefleqkraevdtvcrhnyeifdnflvp
Timeline for d1iead2: