SCOPe 2.07: Domain d6kj8f1: 6kj8 F:11-100

Lineage for d6kj8f1 (6kj8 F:11-100)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (2 families)
   automatically mapped to Pfam PF01948

5. Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein)

6. Protein Aspartate carbamoyltransferase [54895] (3 species)

7. Species Escherichia coli [TaxId:562] [54896] (63 PDB entries)
   Uniprot P00478

8. Domain d6kj8f1: 6kj8 F:11-100 [382074]
   Other proteins in same PDB: d6kj8b2, d6kj8d2, d6kj8f2
   automated match to d2atcb1
   complexed with zn; mutant

Details for d6kj8f1

PDB Entry: 6kj8, 3.01 Å

PDB Description: e. coli atcase holoenzyme mutant - g166p (catalytic chain)

PDB Compounds: (F:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d6kj8f1:

Sequence; same for both SEQRES and ATOM records:

>d6kj8f1 d.58.2.1 (F:11-100) Aspartate carbamoyltransferase {Escherichia coli [TaxId: 562]}
aikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlikientflsedq
vdqlalyapqatvnridnyevvgksrpslp

Timeline for d6kj8f1:

• d6kj8f1 is new in SCOPe 2.07-stable
  
• d6kj8f1 appears in the current release, SCOPe 2.08