Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (2 families) automatically mapped to Pfam PF01948 |
Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein) |
Protein Aspartate carbamoyltransferase [54895] (3 species) |
Species Escherichia coli [TaxId:562] [54896] (63 PDB entries) Uniprot P00478 |
Domain d6kj8f1: 6kj8 F:11-100 [382074] Other proteins in same PDB: d6kj8b2, d6kj8d2, d6kj8f2 automated match to d2atcb1 complexed with zn; mutant |
PDB Entry: 6kj8 (more details), 3.01 Å
SCOPe Domain Sequences for d6kj8f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6kj8f1 d.58.2.1 (F:11-100) Aspartate carbamoyltransferase {Escherichia coli [TaxId: 562]} aikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlikientflsedq vdqlalyapqatvnridnyevvgksrpslp
Timeline for d6kj8f1:
View in 3D Domains from other chains: (mouse over for more information) d6kj8b1, d6kj8b2, d6kj8d1, d6kj8d2 |