Lineage for d1ieab2 (1iea B:4-92)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 31165Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
  4. 31166Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 31167Family d.19.1.1: MHC antigen-recognition domain [54453] (7 proteins)
  6. 31290Protein MHC class II, N-terminal domains of alpha and beta chains [54458] (9 species)
  7. 31357Species Mouse (Mus musculus), I-EK [TaxId:10090] [54465] (2 PDB entries)
  8. 31359Domain d1ieab2: 1iea B:4-92 [38206]
    Other proteins in same PDB: d1ieaa1, d1ieab1, d1ieac1, d1iead1

Details for d1ieab2

PDB Entry: 1iea (more details), 2.3 Å

PDB Description: histocompatibility antigen

SCOP Domain Sequences for d1ieab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ieab2 d.19.1.1 (B:4-92) MHC class II, N-terminal domains of alpha and beta chains {Mouse (Mus musculus), I-EK}
rpwfleycksechfyngtqrvrllvryfynleenlrfdsdvgefravtelgrpdaenwns
qpefleqkraevdtvcrhnyeifdnflvp

SCOP Domain Coordinates for d1ieab2:

Click to download the PDB-style file with coordinates for d1ieab2.
(The format of our PDB-style files is described here.)

Timeline for d1ieab2: