![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
![]() | Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species) |
![]() | Species Mouse (Mus musculus), I-EK [TaxId:10090] [88814] (9 PDB entries) |
![]() | Domain d1ieaa2: 1iea A:1-81 [38205] Other proteins in same PDB: d1ieaa1, d1ieab1, d1ieab2, d1ieac1, d1iead1, d1iead2 complexed with nag fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 1iea (more details), 2.3 Å
SCOPe Domain Sequences for d1ieaa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ieaa2 d.19.1.1 (A:1-81) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), I-EK [TaxId: 10090]} ikeehtiiqaefyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal aniavdkanldvmkersnntp
Timeline for d1ieaa2: