Lineage for d1d9kh2 (1d9k H:2-92)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. Species Mouse (Mus musculus), I-AK [TaxId:10090] [88826] (3 PDB entries)
  8. Domain d1d9kh2: 1d9k H:2-92 [38204]
    Other proteins in same PDB: d1d9ka_, d1d9kb_, d1d9kc1, d1d9kc2, d1d9kd1, d1d9ke_, d1d9kf_, d1d9kg1, d1d9kg2, d1d9kh1
    complexed with nag
    fragment; missing more than one-third of the common structure and/or sequence

Details for d1d9kh2

PDB Entry: 1d9k (more details), 3.2 Å

PDB Description: crystal structure of complex between d10 tcr and pmhc i-ak/ca
PDB Compounds: (H:) MHC I-ak b chain (beta chain)

SCOPe Domain Sequences for d1d9kh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d9kh2 d.19.1.1 (H:2-92) Class II MHC beta chain, N-terminal domain {Mouse (Mus musculus), I-AK [TaxId: 10090]}
gserhfvhqfqpfcyftngtqrirlviryiynreeyvrfdsdvgeyravtelgrpdaeyw
nkqylertraeldtvcrhnyektetptslr

SCOPe Domain Coordinates for d1d9kh2 are not available.

Timeline for d1d9kh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1d9kh1
View in 3D
Domains from other chains:
(mouse over for more information)
d1d9ka_, d1d9kb_, d1d9kc1, d1d9kc2, d1d9kd1, d1d9kd2, d1d9ke_, d1d9kf_, d1d9kg1, d1d9kg2