Lineage for d1d9kd2 (1d9k D:2-92)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 409342Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 409343Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 409344Family d.19.1.1: MHC antigen-recognition domain [54453] (11 proteins)
  6. 409679Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 409742Species Mouse (Mus musculus), I-AK [TaxId:10090] [88826] (3 PDB entries)
  8. 409745Domain d1d9kd2: 1d9k D:2-92 [38202]
    Other proteins in same PDB: d1d9ka_, d1d9kb_, d1d9kc1, d1d9kc2, d1d9kd1, d1d9ke_, d1d9kf_, d1d9kg1, d1d9kg2, d1d9kh1

Details for d1d9kd2

PDB Entry: 1d9k (more details), 3.2 Å

PDB Description: crystal structure of complex between d10 tcr and pmhc i-ak/ca

SCOP Domain Sequences for d1d9kd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d9kd2 d.19.1.1 (D:2-92) Class II MHC beta chain, N-terminal domain {Mouse (Mus musculus), I-AK}
gserhfvhqfqpfcyftngtqrirlviryiynreeyvrfdsdvgeyravtelgrpdaeyw
nkqylertraeldtvcrhnyektetptslr

SCOP Domain Coordinates for d1d9kd2:

Click to download the PDB-style file with coordinates for d1d9kd2.
(The format of our PDB-style files is described here.)

Timeline for d1d9kd2: