Lineage for d1d9kd2 (1d9k D:2-92)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 78647Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
  4. 78648Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 78649Family d.19.1.1: MHC antigen-recognition domain [54453] (7 proteins)
  6. 78785Protein MHC class II, N-terminal domains of alpha and beta chains [54458] (10 species)
  7. 78850Species Mouse (Mus musculus), I-AK [TaxId:10090] [54464] (3 PDB entries)
  8. 78854Domain d1d9kd2: 1d9k D:2-92 [38202]
    Other proteins in same PDB: d1d9ka_, d1d9kb_, d1d9kc1, d1d9kd1, d1d9ke_, d1d9kf_, d1d9kg1, d1d9kh1

Details for d1d9kd2

PDB Entry: 1d9k (more details), 3.2 Å

PDB Description: crystal structure of complex between d10 tcr and pmhc i-ak/ca
PDB Compounds: (D:)

SCOP Domain Sequences for d1d9kd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d9kd2 d.19.1.1 (D:2-92) MHC class II, N-terminal domains of alpha and beta chains {Mouse (Mus musculus), I-AK}
gserhfvhqfqpfcyftngtqrirlviryiynreeyvrfdsdvgeyravtelgrpdaeyw
nkqylertraeldtvcrhnyektetptslr

SCOP Domain Coordinates for d1d9kd2:

Click to download the PDB-style file with coordinates for d1d9kd2.
(The format of our PDB-style files is described here.)

Timeline for d1d9kd2: