Lineage for d1iakb2 (1iak B:5-92)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1197982Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1197983Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 1197984Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1198561Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 1198658Species Mouse (Mus musculus), I-AK [TaxId:10090] [88826] (3 PDB entries)
  8. 1198659Domain d1iakb2: 1iak B:5-92 [38200]
    Other proteins in same PDB: d1iaka1, d1iaka2, d1iakb1
    complexed with nag

Details for d1iakb2

PDB Entry: 1iak (more details), 1.9 Å

PDB Description: histocompatibility antigen i-ak
PDB Compounds: (B:) MHC class II I-ak

SCOPe Domain Sequences for d1iakb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iakb2 d.19.1.1 (B:5-92) Class II MHC beta chain, N-terminal domain {Mouse (Mus musculus), I-AK [TaxId: 10090]}
gsfvhqfqpfcyftngtqrirlviryiynreeyvrfdsdvgeyravtelgrpdaeywnkq
ylertraeldtvcrhnyektetptslr

SCOPe Domain Coordinates for d1iakb2:

Click to download the PDB-style file with coordinates for d1iakb2.
(The format of our PDB-style files is described here.)

Timeline for d1iakb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1iakb1