Lineage for d1iaka2 (1iak A:1-81)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)
  7. Species Mouse (Mus musculus), I-AK [TaxId:10090] [88813] (7 PDB entries)
  8. Domain d1iaka2: 1iak A:1-81 [38199]
    Other proteins in same PDB: d1iaka1, d1iakb1, d1iakb2
    complexed with nag
    fragment; missing more than one-third of the common structure and/or sequence

Details for d1iaka2

PDB Entry: 1iak (more details), 1.9 Å

PDB Description: histocompatibility antigen i-ak
PDB Compounds: (A:) MHC class II I-ak

SCOPe Domain Sequences for d1iaka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iaka2 d.19.1.1 (A:1-81) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), I-AK [TaxId: 10090]}
ieadhvgsygitvyqspgdigqytfefdgdelfyvdldkketvwmlpefaqlrrfepqgg
lqniatgkhnleiltkrsnstp

SCOPe Domain Coordinates for d1iaka2 are not available.

Timeline for d1iaka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1iaka1
View in 3D
Domains from other chains:
(mouse over for more information)
d1iakb1, d1iakb2