Lineage for d6uc6a2 (6uc6 A:1067-1291)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2791605Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2792430Superfamily b.42.4: STI-like [50386] (3 families) (S)
  5. 2792493Family b.42.4.2: Clostridium neurotoxins, C-terminal domain [50399] (3 proteins)
    overall fold is very similar to that of the STI family
    automatically mapped to Pfam PF07951
  6. 2792494Protein Botulinum neurotoxin [50402] (2 species)
  7. 2792495Species Clostridium botulinum, serotype A [TaxId:1491] [50403] (10 PDB entries)
  8. 2792503Domain d6uc6a2: 6uc6 A:1067-1291 [381987]
    Other proteins in same PDB: d6uc6a1, d6uc6b1, d6uc6c_, d6uc6d_
    automated match to d2nm1a2

Details for d6uc6a2

PDB Entry: 6uc6 (more details), 2.32 Å

PDB Description: crystal structure of bont/b receptor-binding domain in complex with vhh jli-h11
PDB Compounds: (A:) botulinum neurotoxin type b

SCOPe Domain Sequences for d6uc6a2:

Sequence, based on SEQRES records: (download)

>d6uc6a2 b.42.4.2 (A:1067-1291) Botulinum neurotoxin {Clostridium botulinum, serotype A [TaxId: 1491]}
sqsnieerykiqsyseylkdfwgnplmynkeyymfnagnknsyiklkkdspvgeiltrsk
ynqnskyinyrdlyigekfiirrksnsqsinddivrkedyiyldffnlnqewrvytykyf
kkeeeklflapisdsdefyntiqikeydeqptyscqllfkkdeestdeigligihrfyes
givfeeykdyfciskwylkevkrkpynlklgcnwqfipkdegwte

Sequence, based on observed residues (ATOM records): (download)

>d6uc6a2 b.42.4.2 (A:1067-1291) Botulinum neurotoxin {Clostridium botulinum, serotype A [TaxId: 1491]}
sqsnieerykiqsyseylkdfwgnplmynkeyymfnagnknsyiklkkdspvgeiltrsk
ynqnskyinyrdlyigekfiirrksnnddivrkedyiyldffnlnqewrvytykyfkkee
eklflapisdsdefyntiqikeydeqptyscqllfkkdeestdeigligihrfyeseykd
yfciskwylkevkrkpynlklgcnwqfipkdegwte

SCOPe Domain Coordinates for d6uc6a2:

Click to download the PDB-style file with coordinates for d6uc6a2.
(The format of our PDB-style files is described here.)

Timeline for d6uc6a2: