![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
![]() | Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species) |
![]() | Species Human (Homo sapiens), HLA-DR4 [TaxId:9606] [88811] (5 PDB entries) |
![]() | Domain d1d5xa2: 1d5x A:3-81 [38197] Other proteins in same PDB: d1d5xa1, d1d5xb1, d1d5xb2, d1d5xc1, d1d5xc2 fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 1d5x (more details), 2.45 Å
SCOPe Domain Sequences for d1d5xa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d5xa2 d.19.1.1 (A:3-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR4 [TaxId: 9606]} eehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalan iavdkanleimtkrsnytp
Timeline for d1d5xa2:
![]() Domains from other chains: (mouse over for more information) d1d5xb1, d1d5xb2, d1d5xc1, d1d5xc2 |