Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.11: Siroheme synthase N-terminal domain-like [75110] (2 proteins) |
Protein Siroheme synthase CysG, domain 1 [102163] (2 species) |
Species Salmonella enterica [TaxId:59201] [381962] (1 PDB entry) |
Domain d6vebb1: 6veb B:1-113 [381968] Other proteins in same PDB: d6veba2, d6veba3, d6vebb2, d6vebb3 automated match to d1pjta1 complexed with cl, nad, pq2, sah |
PDB Entry: 6veb (more details), 2.55 Å
SCOPe Domain Sequences for d6vebb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6vebb1 c.2.1.11 (B:1-113) Siroheme synthase CysG, domain 1 {Salmonella enterica [TaxId: 59201]} mdhlpifcqlrdrdclivgggdvaerkarllleagarltvnaltfipqftvwanegmltl vegpfdetlldscwlaiaatdddtvnqrvsdaaesrrifcnvvdapkaasfim
Timeline for d6vebb1: