SCOPe 2.08: Domain d6vebb1: 6veb B:1-113

Lineage for d6vebb1 (6veb B:1-113)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.11: Siroheme synthase N-terminal domain-like [75110] (2 proteins)

6. Protein Siroheme synthase CysG, domain 1 [102163] (2 species)

7. Species Salmonella enterica [TaxId:59201] [381962] (1 PDB entry)

8. Domain d6vebb1: 6veb B:1-113 [381968]
   Other proteins in same PDB: d6veba2, d6veba3, d6vebb2, d6vebb3
   automated match to d1pjta1
   complexed with cl, nad, pq2, sah

Details for d6vebb1

PDB Entry: 6veb, 2.55 Å

PDB Description: precorrin-2-bound s128a s. typhimurium siroheme synthase

PDB Compounds: (B:) Siroheme synthase

SCOPe Domain Sequences for d6vebb1:

Sequence; same for both SEQRES and ATOM records:

>d6vebb1 c.2.1.11 (B:1-113) Siroheme synthase CysG, domain 1 {Salmonella enterica [TaxId: 59201]}
mdhlpifcqlrdrdclivgggdvaerkarllleagarltvnaltfipqftvwanegmltl
vegpfdetlldscwlaiaatdddtvnqrvsdaaesrrifcnvvdapkaasfim

Timeline for d6vebb1:

• d6vebb1 first appeared in SCOPe 2.07