Lineage for d1d6eb2 (1d6e B:3-92)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 719351Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 719352Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 719353Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 719844Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 719896Species Human (Homo sapiens), HLA-DR4 [TaxId:9606] [88824] (12 PDB entries)
  8. 719912Domain d1d6eb2: 1d6e B:3-92 [38196]
    Other proteins in same PDB: d1d6ea1, d1d6ea2, d1d6eb1, d1d6ec1, d1d6ec2
    complexed with ace

Details for d1d6eb2

PDB Entry: 1d6e (more details), 2.45 Å

PDB Description: crystal structure of hla-dr4 complex with peptidomimetic and seb
PDB Compounds: (B:) protein (hla class II histocompatibility antigen)

SCOP Domain Sequences for d1d6eb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d6eb2 d.19.1.1 (B:3-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR4 [TaxId: 9606]}
trprfleqvkhechffngtervrfldryfyhqeeyvrfdsdvgeyravtelgrpdaeywn
sqkdlleqkraavdtycrhnygvgesftvq

SCOP Domain Coordinates for d1d6eb2:

Click to download the PDB-style file with coordinates for d1d6eb2.
(The format of our PDB-style files is described here.)

Timeline for d1d6eb2: