Lineage for d1d6eb2 (1d6e B:3-92)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 78647Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
  4. 78648Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 78649Family d.19.1.1: MHC antigen-recognition domain [54453] (7 proteins)
  6. 78785Protein MHC class II, N-terminal domains of alpha and beta chains [54458] (10 species)
  7. 78829Species Human (Homo sapiens), HLA-DR4 [TaxId:9606] [54463] (4 PDB entries)
  8. 78835Domain d1d6eb2: 1d6e B:3-92 [38196]
    Other proteins in same PDB: d1d6ea1, d1d6eb1, d1d6ec1, d1d6ec2

Details for d1d6eb2

PDB Entry: 1d6e (more details), 2.45 Å

PDB Description: crystal structure of hla-dr4 complex with peptidomimetic and seb

SCOP Domain Sequences for d1d6eb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d6eb2 d.19.1.1 (B:3-92) MHC class II, N-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR4}
trprfleqvkhechffngtervrfldryfyhqeeyvrfdsdvgeyravtelgrpdaeywn
sqkdlleqkraavdtycrhnygvgesftvq

SCOP Domain Coordinates for d1d6eb2:

Click to download the PDB-style file with coordinates for d1d6eb2.
(The format of our PDB-style files is described here.)

Timeline for d1d6eb2: