Lineage for d1d6ea2 (1d6e A:4-81)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 600225Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 600226Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 600227Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 600497Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)
  7. 600544Species Human (Homo sapiens), HLA-DR4 [TaxId:9606] [88811] (5 PDB entries)
  8. 600547Domain d1d6ea2: 1d6e A:4-81 [38195]
    Other proteins in same PDB: d1d6ea1, d1d6eb1, d1d6eb2, d1d6ec1, d1d6ec2
    complexed with ace

Details for d1d6ea2

PDB Entry: 1d6e (more details), 2.45 Å

PDB Description: crystal structure of hla-dr4 complex with peptidomimetic and seb

SCOP Domain Sequences for d1d6ea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d6ea2 d.19.1.1 (A:4-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR4}
ehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalani
avdkanleimtkrsnytp

SCOP Domain Coordinates for d1d6ea2:

Click to download the PDB-style file with coordinates for d1d6ea2.
(The format of our PDB-style files is described here.)

Timeline for d1d6ea2: